PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.006G057800.1
Common NamePHAVU_006G057800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family NF-YB
Protein Properties Length: 232aa    MW: 25290.5 Da    PI: 5.5992
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.006G057800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB109.61.8e-3452142696
               NF-YB   6 rflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 
                           +Pi+nv++im+k lP+nak+s+ ake++q+ ++++i+fvt++a +kc  e rk +n+ddllwa+ ++Gf++y+ pl ++l++ r++eg 
  Phvul.006G057800.1  52 SKMPITNVTKIMRKFLPNNAKVSDGAKEMIQQSATNYITFVTKKAKEKCLSEYRKIMNADDLLWAIQNVGFDEYIGPLGTFLQRCRNIEGG 142
                         579*************************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.6E-3047142IPR009072Histone-fold
PfamPF008084.1E-1753117IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471131.39E-2353147IPR009072Histone-fold
PRINTSPR006156.7E-78199No hitNo description
PRINTSPR006156.7E-7100118No hitNo description
PRINTSPR006156.7E-7119137No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MEHGGSFFHI DQQVKSSSVP LQQENNYANT EIAAPANSNG GQNPNLIGRD KSKMPITNVT  60
KIMRKFLPNN AKVSDGAKEM IQQSATNYIT FVTKKAKEKC LSEYRKIMNA DDLLWAIQNV  120
GFDEYIGPLG TFLQRCRNIE GGTHGPTFGP GLNPMEMPHP PLPPPPPPPP PPPPPPAAAV  180
YSSGLDFSMH QNTNPEMFDT NDVGGYLEAV GCSSNAFINF DPFSLFQQDQ L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A5e-2154138993NF-YB
4awl_B6e-21541381094NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A6e-21541381094NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150381e-112AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007146648.11e-172hypothetical protein PHAVU_006G057800g
TrEMBLV7BL201e-172V7BL20_PHAVU; Uncharacterized protein
STRINGGLYMA07G29695.14e-49(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.15e-34NF-YB family protein